Primary amines
- (22)
- (140)
- (10)
- (8)
- (4)
- (29)
- (1)
- (4)
- (3)
- (1)
- (72)
- (35)
- (8)
- (2)
- (5)
- (1)
- (1)
- (2)
- (1)
- (1)
- (14)
- (4)
- (1)
- (3)
- (169)
- (57)
- (4)
- (13)
- (17)
- (20)
- (1)
- (6)
- (1)
- (1)
- (1)
- (4)
- (1)
- (181)
- (4)
- (28)
- (15)
- (5)
- (2)
- (41)
- (49)
- (2)
- (1)
- (4)
- (14)
- (3)
- (8)
- (4)
- (4)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (5)
- (1)
- (2)
- (4)
- (1)
- (1)
- (24)
- (2)
- (3)
- (4)
- (7)
- (6)
- (2)
- (3)
- (6)
- (7)
- (13)
- (4)
- (2)
- (2)
- (5)
- (13)
- (4)
- (7)
- (14)
- (4)
- (1)
- (1)
- (6)
- (1)
- (2)
- (10)
- (1)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (2)
- (9)
- (1)
- (3)
- (4)
- (2)
- (2)
- (2)
- (1)
- (9)
- (1)
- (1)
- (3)
- (4)
- (9)
- (4)
- (6)
- (1)
- (2)
- (5)
- (2)
- (2)
- (2)
- (9)
- (5)
- (3)
- (5)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (3)
- (3)
- (5)
- (1)
- (5)
- (3)
- (4)
- (2)
- (2)
- (3)
- (5)
- (8)
- (3)
- (1)
- (1)
- (2)
- (3)
- (7)
- (5)
- (2)
- (3)
- (3)
- (2)
- (3)
- (2)
- (2)
- (8)
- (3)
- (2)
- (3)
- (3)
- (8)
- (1)
- (1)
- (1)
- (6)
- (3)
- (8)
- (2)
- (2)
- (19)
- (4)
- (2)
- (9)
- (8)
- (1)
- (1)
- (1)
- (5)
- (6)
- (2)
- (1)
- (5)
- (11)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (11)
- (1)
- (9)
- (2)
- (1)
- (2)
- (6)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (9)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (6)
- (4)
- (5)
- (1)
- (2)
- (1)
- (2)
- (9)
- (5)
- (16)
- (9)
- (2)
- (8)
- (17)
- (7)
- (5)
- (8)
- (10)
- (10)
- (24)
- (20)
- (2)
- (1)
- (5)
- (8)
- (7)
- (2)
- (1)
- (12)
- (6)
- (6)
- (21)
- (11)
- (7)
- (11)
- (8)
- (4)
- (3)
- (3)
- (8)
- (1)
- (2)
- (4)
- (1)
- (2)
- (2)
- (12)
- (3)
- (3)
- (5)
- (2)
- (7)
- (4)
- (15)
- (2)
- (3)
- (8)
- (6)
- (3)
- (45)
- (2)
- (40)
- (118)
- (2)
- (7)
- (9)
- (6)
- (18)
- (40)
- (4)
- (14)
- (1)
- (6)
- (13)
- (6)
- (11)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (2)
- (1)
- (1)
- (13)
- (2)
- (18)
- (8)
- (76)
- (1)
- (161)
- (10)
- (5)
- (144)
- (29)
- (4)
- (2)
- (2)
- (8)
- (15)
- (177)
- (3)
- (5)
- (1)
- (4)
- (3)
- (4)
- (2)
- (3)
- (331)
- (3)
- (4)
- (6)
- (4)
- (2)
- (27)
- (5)
- (4)
- (4)
- (3)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (3)
- (3)
- (3)
- (3)
- (6)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (3)
- (7)
- (13)
- (2)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (6)
- (2)
- (1)
- (2)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (8)
- (1)
- (1)
- (2)
- (5)
- (5)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (3)
- (1)
- (3)
- (3)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (4)
- (3)
- (2)
- (2)
- (3)
- (1)
- (3)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (7)
- (3)
- (3)
- (2)
- (2)
- (5)
- (4)
- (2)
- (7)
- (1)
- (3)
- (3)
- (3)
- (2)
- (1)
- (2)
- (6)
- (2)
- (4)
- (1)
- (4)
- (2)
- (3)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (3)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (5)
- (2)
- (2)
- (1)
- (5)
- (4)
- (2)
- (4)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (2)
- (1)
- (4)
- (6)
- (3)
- (2)
- (7)
- (2)
- (2)
- (3)
- (2)
- (2)
- (4)
- (10)
- (2)
- (1)
- (5)
- (5)
- (2)
- (1)
- (1)
- (2)
- (4)
- (4)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (5)
- (4)
- (5)
- (4)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (2)
- (3)
- (3)
- (1)
- (3)
- (4)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (7)
- (2)
- (1)
Filtered Search Results
Sigma Aldrich Fine Chemicals Biosciences SIGMA ALDRICH FINE CHEMICALS BIOSCIENCES
NC4013068 TRAZODONE HYDROCHLORIDE
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC MEDCHEMEXPRESS LLC
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
5000283359 TERT-BUTYLAMINE BORA 100G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 62281-05-4 | 2-Hexyldecan-1-amine | Ambeed | MFCD30475384 | 241.463 | C16H35N | 98.000 | CCCCCCCCC(CN)CCCCCC | 250mg | 600841103
2-Hexyldecan-1-amine | Ambeed | 62281-05-4 | MFCD30475384 | 241.463 | C16H35N | 98.000 | CCCCCCCCC(CN)CCCCCC | 250mg | 600841103
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules EMOLECULES INC
5000841751 N-BOC-CYCLOPROPYLAMINE 5G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chem-Impex International, Inc. 2-Cyclohexyl ethylamine | 4442-85-7 | MFCD00058668 | 1G
2-Cyclohexyl ethylamine, 4442-85-7, MFCD00058668, 1G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chemscene ChemScene | Amantadine | 100G | CS-W008656 | 0.98 | 768-94-5| MFCD00074732 | 151.25
ChemScene | Amantadine | 100G | CS-W008656 | 0.98 | 768-94-5| MFCD00074732 | 151.25
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1354940-69-4 | methyl 3-aminocyclobutane-1-carboxylate hydrochloride | MFCD17015886 | 1g
AstaTech | ETHYL 2-CHLORO-5-NITROBENZOATE | 1g | 449717179 | 20574 | 95.000 | 16588-17-3 | MFCD00115803 | 229.620 | C9H8ClNO4
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC P-TYRAMINE-D4 HYDRO 1 mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
P-TYRAMINE-D4 HYDRO 1MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Aobchem 2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 250mg
2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 250mg
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC ICCB-19 (hydrochloride) | 1803605-68-6 | 99.3% | 291.84 | C12H22ClN3OS | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ICCB-19 hydrochloride is a research-grade small molecule that inhibits TRADD-mediated signaling and indirectly inhibits RIPK1 kinase activity. It has been reported to induce autophagy, modulate TNF-induced inflammatory responses, and affect RIPK1-dependent apoptosis in cellular and animal models.
- Targets TRADD and indirectly inhibits RIPK1 kinase activity.
- Binds TRADD N-terminal domain to disrupt protein interactions.
- Promotes autophagy via K63-linked ubiquitination of Beclin-1.
- Reduces TNF-induced inflammatory gene expression in cell and animal studies.
- Provided as a hydrochloride salt with reported high purity.
- Available as solid and DMSO solution aliquots for research use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC 12-((cyclohexylcarbamoyl)amino)dodecanoic acid | 479413-68-8 | 99.8% | 10 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CUDA is a research-grade small-molecule inhibitor of soluble epoxide hydrolase (sEH) used in biochemical and cellular studies to probe sEH and PPAR-alpha pathways. It is supplied as a crystalline solid (CAS 479413-68-8) with molecular formula C19H36N2O3 and molecular weight 340.50 g/mol.
- Potent sEH inhibitor with IC50 = 11.1 nM (mouse) and 112 nM (human).
- High purity by HPLC (approximately 99.8%).
- Supplied in small solid quantities suitable for assay development and cellular studies.
- Soluble in common organic solvents for stock solution preparation.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 1965304-87-3 | 2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | 1965304-87-3 | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Silydianin | 29782-68-1 | MFCD09970974 | 482.44 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Silydianin is a flavonolignan obtained from *Silybum marianum*. It inhibits PTP1B, monophenolase, and diphenolase of tyrosinase. Silydianin induces apoptosis and reduces cytokines (IL-4 and IL-5). It also exhibits antitumor activity against prostate cancer. As part of Silymarin, it contributes to antioxidant, cytoprotective, and immunomodulatory effects, and can be used in allergic asthma research.
- Flavonolignan
- Inhibits PTP1B
- Inhibits monophenolase and diphenolase of tyrosinase
- Induces apoptosis and reduces cytokines (IL-4 and IL-5)
- Antioxidant, cytoprotective and immunomodulatory effects
- Antitumor activity against prostate cancer
- Used in allergic asthma research
- Appearance: solid, white to off-white
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 62-53-3 | Aniline, 99.5%, ACS grade | Oakwood Chemical | MFCD00007629 | 93.129 | C6H7N | 0.000 | Nc1ccccc1 | 100g | 854221465
Aniline, 99.5%, ACS grade | Oakwood Chemical | 62-53-3 | MFCD00007629 | 93.129 | C6H7N | 0.000 | Nc1ccccc1 | 100g | 854221465
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More